RetrogeneDB ID: | retro_mmus_3675 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:101691547..101691850(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000082729 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Vma21 | ||
| Ensembl ID: | ENSMUSG00000073131 | ||
| Aliases: | Vma21, 2610030H06Rik, AI840175 | ||
| Description: | VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914298] |
| Percent Identity: | 92.08 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MERLDKAALNALQPPEFRNENSLAATLKTLLFFTALMITVPIGLYFTTKAYIFEGALGMSNRDSYFYAAI |
| MERLDKAALNALQPPEFRNENSLAATLKTLLFFTALMITVPIGLYFTTKAYIF.GALGMSNRDSYFYAA. | |
| Retrocopy | MERLDKAALNALQPPEFRNENSLAATLKTLLFFTALMITVPIGLYFTTKAYIFGGALGMSNRDSYFYAAX |
| Parental | VAVVAVHVVLALFVYVAWNEGSRQWREGKQD |
| ......HVVLALFVYVAWNEGSRQWREGKQD | |
| Retrocopy | XXXXXXHVVLALFVYVAWNEGSRQWREGKQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 27 .03 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 26 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .70 RPM |
| SRP007412_kidney | 0 .02 RPM | 16 .82 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .54 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .74 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006296 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003916 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008426 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006467 | 1 retrocopy | |
| Homo sapiens | ENSG00000160131 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009034 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000073131 | 2 retrocopies |
retro_mmus_116, retro_mmus_3675 ,
|
| Nomascus leucogenys | ENSNLEG00000013711 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015201 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020820 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022372 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000049744 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011179 | 1 retrocopy |