RetrogeneDB ID: | retro_nleu_556 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397267.1:4667030..4667264(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TRMT112 | ||
Ensembl ID: | ENSNLEG00000004991 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 57.69 % |
Parental protein coverage: | 55.32 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRIFPISRGIP |
M.P..EW.A.LEAA..L.L..V.KG...GYE..E.F.R.MHH.LL...V.E.TLQC.ES.....ISRG.P | |
Retrocopy | MLPTMEWAALLEAAKTLDLLKVSKGLIQGYEHYEKFPREMHHMLL*LDVLEDTLQCAESRHLSHISRGDP |
Parental | NMLLSEEE |
NMLLS.EE | |
Retrocopy | NMLLSDEE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017965 | 3 retrocopies | |
Bos taurus | ENSBTAG00000008646 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000018026 | 1 retrocopy | |
Equus caballus | ENSECAG00000016960 | 1 retrocopy | |
Homo sapiens | ENSG00000173113 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000001334 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000019647 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004991 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000025906 | 5 retrocopies | |
Pteropus vampyrus | ENSPVAG00000017134 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000019857 | 1 retrocopy |