RetrogeneDB ID: | retro_pabe_1182 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 14:61716872..61717085(-) | ||
| Located in intron of: | ENSPPYG00000005876 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGN2 | ||
| Ensembl ID: | ENSPPYG00000001682 | ||
| Aliases: | None | ||
| Description: | non-histone chromosomal protein HMG-17 [Source:RefSeq peptide;Acc:NP_001125775] |
| Percent Identity: | 87.32 % |
| Parental protein coverage: | 78.89 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPA |
| MPKRK.EGDAKGDKAK.KDEPQRRSARLSA.PAPPKPE.KPKKAPAKKGEKVPKGKKGKADAGKEG.... | |
| Retrocopy | MPKRKTEGDAKGDKAKMKDEPQRRSARLSATPAPPKPESKPKKAPAKKGEKVPKGKKGKADAGKEGEGAG |
| Parental | E |
| . | |
| Retrocopy | D |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 2 .71 RPM | 13 .49 RPM |
| SRP007412_cerebellum | 3 .16 RPM | 12 .52 RPM |
| SRP007412_heart | 0 .51 RPM | 12 .19 RPM |
| SRP007412_kidney | 2 .62 RPM | 20 .78 RPM |
| SRP007412_liver | 2 .08 RPM | 23 .01 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1427 |