RetrogeneDB ID: | retro_pabe_1182 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 14:61716872..61717085(-) | ||
Located in intron of: | ENSPPYG00000005876 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGN2 | ||
Ensembl ID: | ENSPPYG00000001682 | ||
Aliases: | None | ||
Description: | non-histone chromosomal protein HMG-17 [Source:RefSeq peptide;Acc:NP_001125775] |
Percent Identity: | 87.32 % |
Parental protein coverage: | 78.89 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPA |
MPKRK.EGDAKGDKAK.KDEPQRRSARLSA.PAPPKPE.KPKKAPAKKGEKVPKGKKGKADAGKEG.... | |
Retrocopy | MPKRKTEGDAKGDKAKMKDEPQRRSARLSATPAPPKPESKPKKAPAKKGEKVPKGKKGKADAGKEGEGAG |
Parental | E |
. | |
Retrocopy | D |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 2 .71 RPM | 13 .49 RPM |
SRP007412_cerebellum | 3 .16 RPM | 12 .52 RPM |
SRP007412_heart | 0 .51 RPM | 12 .19 RPM |
SRP007412_kidney | 2 .62 RPM | 20 .78 RPM |
SRP007412_liver | 2 .08 RPM | 23 .01 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1427 |