RetrogeneDB ID: | retro_pabe_1864 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 21:45324691..45325119(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MYL6 | ||
Ensembl ID: | ENSPPYG00000004647 | ||
Aliases: | None | ||
Description: | myosin light polypeptide 6 [Source:RefSeq peptide;Acc:NP_001126203] |
Percent Identity: | 80.56 % |
Parental protein coverage: | 94.7 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | TAEFKEAFQLFDRTGDGKIL-YSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTV |
..EFK.AF.LFD.TGDGK.L..S.CGD.MRALGQNPTNA..L.VLGNPKSDEMNVKVLDFEH.LP.LQTV | |
Retrocopy | STEFKAAFRLFD*TGDGKVL<SSPCGDMMRALGQNPTNAAALEVLGNPKSDEMNVKVLDFEHSLPLLQTV |
Parental | AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEELVRM |
A.NKDQGTYEDYVE.L.VFDKE.NGTVMGAEIRHVLV.LGE.MTEE..EMLVAGHEDSNGCI....LVR. | |
Retrocopy | AGNKDQGTYEDYVERLQVFDKEENGTVMGAEIRHVLVSLGEEMTEEGGEMLVAGHEDSNGCIDSKVLVRR |
Parental | VLNG |
VLNG | |
Retrocopy | VLNG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 140 .94 RPM |
SRP007412_cerebellum | 0 .00 RPM | 193 .71 RPM |
SRP007412_heart | 0 .00 RPM | 149 .37 RPM |
SRP007412_kidney | 0 .00 RPM | 341 .88 RPM |
SRP007412_liver | 0 .00 RPM | 295 .80 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2533 |
Pan troglodytes | retro_ptro_1476 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Macropus eugenii | ENSMEUG00000001272 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000031838 | 6 retrocopies | |
Mus musculus | ENSMUSG00000090841 | 7 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000205 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000017371 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000034596 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004646 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004647 | 3 retrocopies |
retro_pabe_1467, retro_pabe_1864 , retro_pabe_538,
|
Sarcophilus harrisii | ENSSHAG00000004472 | 6 retrocopies | |
Sus scrofa | ENSSSCG00000025467 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000023318 | 1 retrocopy |