RetrogeneDB ID: | retro_pabe_2367 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 3:153593095..153593338(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPC | ||
Ensembl ID: | ENSPPYG00000029902 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptide C [Source:HGNC Symbol;Acc:11157] |
Percent Identity: | 76.54 % |
Parental protein coverage: | 81.82 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP |
MPKF.CD.C.TYLTHDSPSVR..HCSGRKHKENVKDYYQKW.EEQA.SL.D.T..A.Q.G..PPT.FS.P | |
Retrocopy | MPKFCCDFCNTYLTHDSPSVRTYHCSGRKHKENVKDYYQKWIEEQARSLADRTKTASQKGRTPPTLFSVP |
Parental | PPAGAMIPPPP |
PPAGAMI..PP | |
Retrocopy | PPAGAMIHSPP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .17 RPM | 4 .20 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .93 RPM |
SRP007412_heart | 0 .00 RPM | 7 .71 RPM |
SRP007412_kidney | 0 .13 RPM | 5 .63 RPM |
SRP007412_liver | 0 .18 RPM | 4 .80 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2865 |
Pan troglodytes | retro_ptro_1937 |
Gorilla gorilla | retro_ggor_1981 |
Macaca mulatta | retro_mmul_1465 |