RetrogeneDB ID: | retro_pabe_3613 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | X:12294786..12295001(+) | ||
Located in intron of: | ENSPPYG00000020124 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAU | ||
Ensembl ID: | ENSPPYG00000003077 | ||
Aliases: | None | ||
Description: | 40S ribosomal protein S30 [Source:UniProtKB/Swiss-Prot;Acc:P0C2F0] |
Percent Identity: | 50.68 % |
Parental protein coverage: | 54.14 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | PEDQVVLLAGAPLEDEATLG-QCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTG |
PE.QV.L.....LEDE...G...GVEALTTL.VA....G.K.HG.LA.A..VR.QT.KVA..E.K..... | |
Retrocopy | PEGQVML*EDTALEDEXXXG<DSGVEALTTLKVASCVPGVKFHGFLACAREVRVQTSKVAYKENKRLRRR |
Parental | RAK |
R.. | |
Retrocopy | RKR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 73 .65 RPM |
SRP007412_cerebellum | 0 .12 RPM | 45 .24 RPM |
SRP007412_heart | 0 .00 RPM | 40 .01 RPM |
SRP007412_kidney | 0 .00 RPM | 115 .75 RPM |
SRP007412_liver | 0 .00 RPM | 138 .84 RPM |