RetrogeneDB ID: | retro_dnov_1593 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_24289:37638..37861(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000004481 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.75 % |
| Parental protein coverage: | 58.65 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | QCGVEALTTLEVAGRMLGGKVHG-SLARAGK-VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTF |
| QCGVEAL..LEVAG.ML.GKVHG.SLARAGK.VRGQTP.VAKQE...KK.G..K..MQYN..FVNVVPTF | |
| Retrocopy | QCGVEALAALEVAGLMLRGKVHG<SLARAGK<VRGQTPMVAKQE---KKMGQVKQQMQYNPCFVNVVPTF |
| Parental | GKKKGPNANS |
| GKKKGPNANS | |
| Retrocopy | GKKKGPNANS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 470 .42 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 510 .15 RPM |
| SRP012922_heart | 0 .00 RPM | 365 .68 RPM |
| SRP012922_kidney | 0 .00 RPM | 655 .47 RPM |
| SRP012922_liver | 0 .00 RPM | 270 .14 RPM |
| SRP012922_lung | 0 .00 RPM | 1025 .85 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 430 .29 RPM |
| SRP012922_spleen | 0 .00 RPM | 1168 .42 RPM |