RetrogeneDB ID: | retro_pabe_380 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:45073143..45073498(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SPCS1 | ||
Ensembl ID: | ENSPPYG00000013798 | ||
Aliases: | None | ||
Description: | Signal peptidase complex subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5RF96] |
Percent Identity: | 66.12 % |
Parental protein coverage: | 70.41 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | PSPRSLPPALSCPPPQPAMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIV |
PSP....PAL...PP.P.MLEH.S.LP...DYKGQKL.EQMFQ.II.FS...GFIYGYVAE....TVYIV | |
Retrocopy | PSPCCPLPALHHLPPWPVMLEHMSLLPIRIDYKGQKLVEQMFQRIIIFSSVIGFIYGYVAEHCR*TVYIV |
Parental | MAGFAFSCLLTLPPWPIYRRHPLKWLPVQESS-TDDKK-PGERKIKRHAKN |
.AGFAFS.LLTL..WPI...HPLK.L.VQ.SS.T...K..G.RKIKRHAKN | |
Retrocopy | IAGFAFSHLLTLHLWPIHQWHPLKRLLVQDSS<TKNEK<AGDRKIKRHAKN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 24 .88 RPM |
SRP007412_cerebellum | 0 .00 RPM | 25 .54 RPM |
SRP007412_heart | 0 .00 RPM | 12 .10 RPM |
SRP007412_kidney | 0 .03 RPM | 33 .91 RPM |
SRP007412_liver | 0 .03 RPM | 28 .25 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_294 |
Pan troglodytes | retro_ptro_241 |
Gorilla gorilla | retro_ggor_332 |
Macaca mulatta | retro_mmul_549 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008426 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000008927 | 1 retrocopy | |
Equus caballus | ENSECAG00000023559 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000007914 | 1 retrocopy | |
Homo sapiens | ENSG00000114902 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000028027 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000014061 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000000744 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000017370 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000004106 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000013798 | 1 retrocopy |
retro_pabe_380 ,
|
Pan troglodytes | ENSPTRG00000015011 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000006854 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000008576 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000007380 | 1 retrocopy |