RetrogeneDB ID: | retro_pabe_475 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:189733225..189733646(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL10A | ||
Ensembl ID: | ENSPPYG00000016529 | ||
Aliases: | None | ||
Description: | ribosomal protein L10a [Source:HGNC Symbol;Acc:10299] |
Percent Identity: | 81.12 % |
Parental protein coverage: | 73.82 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | AKAVDIPHMDIEALK-KLNKNKK-LVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENM |
.KAVDI.H.DI..LK.KLNKN...LVK.L.KKYD.FLASESLIKQIP.ILGPGLNK.GKFPSLLTHN.NM | |
Retrocopy | SKAVDILHRDIKVLK<KLNKNTN<LVKQLSKKYDVFLASESLIKQIP*ILGPGLNKVGKFPSLLTHNKNM |
Parental | VAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQ |
..KVDEVKST.KFQMK.VLCLAVAVGHVKMTDDELV.NIHLAVNFLVSLLKKN.Q..RALYI.ST.GKP. | |
Retrocopy | AHKVDEVKSTTKFQMKRVLCLAVAVGHVKMTDDELVHNIHLAVNFLVSLLKKNCQHIRALYIESTVGKPR |
Parental | RLY |
.LY | |
Retrocopy | HLY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 74 .53 RPM |
SRP007412_cerebellum | 0 .00 RPM | 76 .12 RPM |
SRP007412_heart | 0 .00 RPM | 94 .83 RPM |
SRP007412_kidney | 0 .00 RPM | 196 .86 RPM |
SRP007412_liver | 0 .00 RPM | 146 .15 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_142 |
Pan troglodytes | retro_ptro_142 |
Gorilla gorilla | retro_ggor_234 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Equus caballus | ENSECAG00000014090 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000005760 | 6 retrocopies | |
Monodelphis domestica | ENSMODG00000013766 | 2 retrocopies | |
Mus musculus | ENSMUSG00000037805 | 8 retrocopies | |
Ornithorhynchus anatinus | ENSOANG00000014574 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016529 | 10 retrocopies |
retro_pabe_1208, retro_pabe_1597, retro_pabe_2614, retro_pabe_2759, retro_pabe_3302, retro_pabe_3315, retro_pabe_3377, retro_pabe_357, retro_pabe_451, retro_pabe_475 ,
|
Sarcophilus harrisii | ENSSHAG00000002047 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000001543 | 7 retrocopies |