RetrogeneDB ID: | retro_ptro_2140 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:34885112..34885339(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DBI | ||
Ensembl ID: | ENSPTRG00000012401 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.13 % |
Parental protein coverage: | 73.08 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | FEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDA-WNELKGTSKEDAMKAY |
FEKAA....HL.TKP.D.E..FIY.H.KQATV.D.NTE.P.MLD..GKAK.DA.WNELK.T.KEDA.KA. | |
Retrocopy | FEKAAKDIKHLETKPADDERMFIYSHCKQATVHDLNTEWPRMLDLKGKAKQDA<WNELKDTAKEDAVKAD |
Parental | INKVEEL |
INKVEEL | |
Retrocopy | INKVEEL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 44 .11 RPM |
SRP007412_cerebellum | 0 .00 RPM | 98 .91 RPM |
SRP007412_heart | 0 .00 RPM | 60 .59 RPM |
SRP007412_kidney | 0 .05 RPM | 76 .13 RPM |
SRP007412_liver | 0 .10 RPM | 103 .80 RPM |
SRP007412_testis | 0 .11 RPM | 67 .87 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3345 |
Gorilla gorilla | retro_ggor_1289 |
Pongo abelii | retro_pabe_2755 |