RetrogeneDB ID: | retro_ptro_1209 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 17:8882517..8882733(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX6B1 | ||
Ensembl ID: | ENSPTRG00000010854 | ||
Aliases: | None | ||
Description: | Cytochrome c oxidase subunit VIb polypeptide 1 (Ubiquitous) [Source:UniProtKB/TrEMBL;Acc:K7CTL6] |
Percent Identity: | 68.06 % |
Parental protein coverage: | 80.9 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | YKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGT |
YKTA.FDS.FPNQNQ.RNC.Q.YLDFH.C.KA..AKG....VCEWYQ.VY.SL.P.SWV..WD...AE.T | |
Retrocopy | YKTALFDSSFPNQNQPRNCLQDYLDFHLCEKAVIAKGDNVFVCEWYQPVYKSLIPISWVSAWDDHWAEAT |
Parental | FP |
FP | |
Retrocopy | FP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 105 .24 RPM |
SRP007412_cerebellum | 0 .00 RPM | 32 .23 RPM |
SRP007412_heart | 0 .00 RPM | 100 .26 RPM |
SRP007412_kidney | 0 .00 RPM | 133 .19 RPM |
SRP007412_liver | 0 .00 RPM | 52 .64 RPM |
SRP007412_testis | 0 .00 RPM | 18 .55 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1762 |
Macaca mulatta | retro_mmul_1227 |