RetrogeneDB ID: | retro_ptro_147 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:52254521..52254788(+) | ||
Located in intron of: | ENSPTRG00000000731 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TSEN15 | ||
Ensembl ID: | ENSPTRG00000023202 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 75.28 % |
Parental protein coverage: | 52.05 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | VAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASFSHNRIREILKASRKLQG |
.AF.VYLDLME.K.WHEVNCV.LPE.QLIC.V.TE.EGEGLQT.VPTPITAS.SHNR.R.ILKAS.K..G | |
Retrocopy | IAFSVYLDLMEHKNWHEVNCVRLPEPQLICFVCTETEGEGLQTMVPTPITASLSHNRTRGILKAS*KV*G |
Parental | DPDLPMSFTLAIVESDSTI |
DPDL..SFTLAIV.S...I | |
Retrocopy | DPDLAVSFTLAIVVSNYII |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 13 .42 RPM |
SRP007412_cerebellum | 0 .00 RPM | 10 .58 RPM |
SRP007412_heart | 0 .00 RPM | 14 .54 RPM |
SRP007412_kidney | 0 .00 RPM | 18 .65 RPM |
SRP007412_liver | 0 .00 RPM | 11 .72 RPM |
SRP007412_testis | 0 .00 RPM | 11 .80 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_240 |
Pongo abelii | retro_pabe_469 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000016369 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005356 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000017611 | 2 retrocopies | |
Homo sapiens | ENSG00000198860 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015804 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000014109 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016409 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000011790 | 1 retrocopy | |
Mus musculus | ENSMUSG00000014980 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000018024 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000003128 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000421 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000023202 | 2 retrocopies |
retro_ptro_1229, retro_ptro_147 ,
|
Pteropus vampyrus | ENSPVAG00000001103 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000013230 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000002941 | 2 retrocopies |