RetrogeneDB ID: | retro_pabe_3196 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 7_random:2454159..2454447(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TSEN15 | ||
| Ensembl ID: | ENSPPYG00000000421 | ||
| Aliases: | None | ||
| Description: | tRNA splicing endonuclease 15 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:16791] |
| Percent Identity: | 73.74 % |
| Parental protein coverage: | 53.01 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | APSWAPE-DAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIE |
| APSWA...D.WMGTHPK.LEMME...GD..QVY.AFLVYLDLMESKSWHEVNCV...ELQLICLV..... | |
| Retrocopy | APSWALQ>DGWMGTHPKCLEMME*STGDDIQVYIAFLVYLDLMESKSWHEVNCV*MLELQLICLV-LS*K |
| Parental | GEG-LQTVVPTPITASLSHNRIREILKAS |
| G.G.LQTVV.T..TASLSHN..REILKAS | |
| Retrocopy | GRG<LQTVVSTRFTASLSHNCSREILKAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .83 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .09 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .81 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .76 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .92 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016369 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005356 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017611 | 2 retrocopies | |
| Homo sapiens | ENSG00000198860 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015804 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000014109 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016409 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011790 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000014980 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000018024 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003128 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000421 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000023202 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000001103 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013230 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000002941 | 2 retrocopies |