RetrogeneDB ID: | retro_ptro_1477 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 21:30043346..30043578(-) | ||
Located in intron of: | ENSPTRG00000013968 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | H2AFZ | ||
Ensembl ID: | ENSPTRG00000016312 | ||
Aliases: | None | ||
Description: | H2A histone family, member Z [Source:HGNC Symbol;Acc:4741] |
Percent Identity: | 74.68 % |
Parental protein coverage: | 60.94 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVG-RIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLEL |
MAG.K.GKDS.KAKT.AVSRSQ...L..P.G..IHRHLKSRT..HGRVG.TAAVY..AILEYL.AE.LEL | |
Retrocopy | MAGSKVGKDSRKAKTQAVSRSQ-SRLAAPRG>HIHRHLKSRTARHGRVGVTAAVYNTAILEYLAAEGLEL |
Parental | AGNASKDLK |
AGNAS.DLK | |
Retrocopy | AGNASEDLK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .09 RPM | 64 .42 RPM |
SRP007412_cerebellum | 0 .04 RPM | 57 .61 RPM |
SRP007412_heart | 0 .00 RPM | 18 .27 RPM |
SRP007412_kidney | 0 .05 RPM | 48 .17 RPM |
SRP007412_liver | 0 .00 RPM | 54 .70 RPM |
SRP007412_testis | 0 .00 RPM | 119 .50 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2534 |