RetrogeneDB ID: | retro_ptro_2023 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 4:152797933..152798260(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AKIRIN2 | ||
Ensembl ID: | ENSPTRG00000018409 | ||
Aliases: | None | ||
Description: | Pan troglodytes akirin 2 (AKIRIN2), mRNA. [Source:RefSeq mRNA;Acc:NM_001251907] |
Percent Identity: | 84.96 % |
Parental protein coverage: | 54.68 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | QKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEK |
QKRR..ETSFQ.TDPCCTSDA..HAFLLSG.ASPGTSSAASSPLKKEQPLFTL.QVGMICE..LKE.EEK | |
Retrocopy | QKRRYSETSFQDTDPCCTSDA--HAFLLSGSASPGTSSAASSPLKKEQPLFTLWQVGMICEH*LKEHEEK |
Parental | VREEYEE-ILNTKLAEQ-YDAFVKFTHDQIMRRYGEQPASYVS |
V.EEYEE.ILNTKLAEQ..DA.VKFTHDQIM.RYGE.PASYVS | |
Retrocopy | VWEEYEE<ILNTKLAEQ>NDASVKFTHDQIM*RYGEEPASYVS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 30 .99 RPM |
SRP007412_cerebellum | 0 .00 RPM | 30 .44 RPM |
SRP007412_heart | 0 .00 RPM | 15 .74 RPM |
SRP007412_kidney | 0 .00 RPM | 21 .37 RPM |
SRP007412_liver | 0 .03 RPM | 21 .44 RPM |
SRP007412_testis | 0 .00 RPM | 38 .78 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2991 |
Gorilla gorilla | retro_ggor_2071 |
Pongo abelii | retro_pabe_2477 |
Macaca mulatta | retro_mmul_1914 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000003082 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000012160 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000000769 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000000549 | 1 retrocopy | |
Homo sapiens | ENSG00000135334 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002448 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002824 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016831 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018409 | 1 retrocopy |
retro_ptro_2023 ,
|
Rattus norvegicus | ENSRNOG00000008288 | 1 retrocopy | |
Sorex araneus | ENSSARG00000006084 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000011555 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000004307 | 1 retrocopy |