RetrogeneDB ID: | retro_ptro_269 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:221730548..221730988(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL10A | ||
Ensembl ID: | ENSPTRG00000018085 | ||
Aliases: | None | ||
Description: | ribosomal protein L10a [Source:HGNC Symbol;Acc:10299] |
Percent Identity: | 81.46 % |
Parental protein coverage: | 69.12 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | SVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILG-PGLNKAG |
SVCVL..QQHC.EAKAVDIPHMDIE.LKK.N.NKKLVKKLAKK.DA.LASESLIKQIP..L..PGL.KAG | |
Retrocopy | SVCVLEKQQHCNEAKAVDIPHMDIEVLKKFNQNKKLVKKLAKK*DALLASESLIKQIPKVLA<PGLHKAG |
Parental | KFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVR |
.FPSLL.HNEN....VDEVKSTIKFQM.KVLCLAV.VGHV..TD..LVYNIHL.VNFLVSLLKKNWQNV. | |
Retrocopy | TFPSLLIHNEN---EVDEVKSTIKFQMTKVLCLAVTVGHVNVTDNKLVYNIHLTVNFLVSLLKKNWQNV* |
Parental | ALYIKSTMGKP |
ALYIK.TMGKP | |
Retrocopy | ALYIKRTMGKP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 141 .85 RPM |
SRP007412_cerebellum | 0 .00 RPM | 162 .07 RPM |
SRP007412_heart | 0 .00 RPM | 92 .39 RPM |
SRP007412_kidney | 0 .00 RPM | 279 .14 RPM |
SRP007412_liver | 0 .00 RPM | 160 .59 RPM |
SRP007412_testis | 0 .00 RPM | 43 .42 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_337 |
Gorilla gorilla | retro_ggor_358 |
Pongo abelii | retro_pabe_357 |
Macaca mulatta | retro_mmul_583 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000001318 | 18 retrocopies | |
Echinops telfairi | ENSETEG00000013325 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000028140 | 10 retrocopies | |
Macropus eugenii | ENSMEUG00000005760 | 6 retrocopies | |
Myotis lucifugus | ENSMLUG00000000080 | 10 retrocopies | |
Monodelphis domestica | ENSMODG00000013766 | 2 retrocopies | |
Ornithorhynchus anatinus | ENSOANG00000014574 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004065 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000018085 | 13 retrocopies | |
Pteropus vampyrus | ENSPVAG00000002763 | 9 retrocopies | |
Rattus norvegicus | ENSRNOG00000000505 | 4 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000002047 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000023366 | 3 retrocopies |