RetrogeneDB ID: | retro_ptro_413 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 10:23620615..23620908(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMEM230 | ||
Ensembl ID: | ENSPTRG00000013221 | ||
Aliases: | None | ||
Description: | transmembrane protein 230 [Source:HGNC Symbol;Acc:15876] |
Percent Identity: | 75.76 % |
Parental protein coverage: | 53.01 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | LWQRVMMPSRTNLATGIPSSKVKYSRLSSTDDGYID-LQFKKTPPKIPYKAIALATVLFLIGAFL-IIIG |
L.QRVMMPS.TNLATGIPSSK.KYSRLSSTD.GY...L.FKK..PK.P.KA.A..TVLFLIG.FL.IIIG | |
Retrocopy | LCQRVMMPSHTNLATGIPSSKAKYSRLSSTDSGYTHLLRFKKGLPKMP*KATAVTTVLFLIGTFL<IIIG |
Parental | SLLLSGYISKGGADRAVPVLIIGILVFLP |
SLLL.GYISK.G.D..VPVLI.G.LVFLP | |
Retrocopy | SLLLLGYISKVGTD*VVPVLITGNLVFLP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 52 .30 RPM |
SRP007412_cerebellum | 0 .00 RPM | 33 .48 RPM |
SRP007412_heart | 0 .00 RPM | 30 .69 RPM |
SRP007412_kidney | 0 .00 RPM | 54 .45 RPM |
SRP007412_liver | 0 .00 RPM | 35 .71 RPM |
SRP007412_testis | 0 .00 RPM | 20 .87 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_550 |
Pongo abelii | retro_pabe_507 |
Macaca mulatta | retro_mmul_2386 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000006063 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000010231 | 12 retrocopies | |
Callithrix jacchus | ENSCJAG00000021275 | 2 retrocopies | |
Erinaceus europaeus | ENSEEUG00000014992 | 1 retrocopy | |
Homo sapiens | ENSG00000089063 | 3 retrocopies | |
Loxodonta africana | ENSLAFG00000006412 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000023089 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000013258 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000007719 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000001386 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000010796 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000013221 | 4 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000019378 | 1 retrocopy |