RetrogeneDB ID: | retro_ptro_413 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 10:23620615..23620908(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM230 | ||
| Ensembl ID: | ENSPTRG00000013221 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 230 [Source:HGNC Symbol;Acc:15876] |
| Percent Identity: | 75.76 % |
| Parental protein coverage: | 53.01 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | LWQRVMMPSRTNLATGIPSSKVKYSRLSSTDDGYID-LQFKKTPPKIPYKAIALATVLFLIGAFL-IIIG |
| L.QRVMMPS.TNLATGIPSSK.KYSRLSSTD.GY...L.FKK..PK.P.KA.A..TVLFLIG.FL.IIIG | |
| Retrocopy | LCQRVMMPSHTNLATGIPSSKAKYSRLSSTDSGYTHLLRFKKGLPKMP*KATAVTTVLFLIGTFL<IIIG |
| Parental | SLLLSGYISKGGADRAVPVLIIGILVFLP |
| SLLL.GYISK.G.D..VPVLI.G.LVFLP | |
| Retrocopy | SLLLLGYISKVGTD*VVPVLITGNLVFLP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 52 .30 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 33 .48 RPM |
| SRP007412_heart | 0 .00 RPM | 30 .69 RPM |
| SRP007412_kidney | 0 .00 RPM | 54 .45 RPM |
| SRP007412_liver | 0 .00 RPM | 35 .71 RPM |
| SRP007412_testis | 0 .00 RPM | 20 .87 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_550 |
| Pongo abelii | retro_pabe_507 |
| Macaca mulatta | retro_mmul_2386 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006063 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000010231 | 12 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021275 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014992 | 1 retrocopy | |
| Homo sapiens | ENSG00000089063 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000006412 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000023089 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013258 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000007719 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000001386 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000010796 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000013221 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000019378 | 1 retrocopy |