RetrogeneDB ID: | retro_ptro_901 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 14:33844327..33844736(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | IGBP1 | ||
| Ensembl ID: | ENSPTRG00000021990 | ||
| Aliases: | None | ||
| Description: | immunoglobulin (CD79A) binding protein 1 [Source:HGNC Symbol;Acc:5461] |
| Percent Identity: | 88.49 % |
| Parental protein coverage: | 52.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | CHCYHVAEFELPKTMNNSAE-NHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQA |
| CHCYHVAE.ELPKT..NSAE.NHTAN.SMAYPSL.AMASQRQAK..R.KQK.ELEHRLSA.KSAVESGQA | |
| Retrocopy | CHCYHVAELELPKT-KNSAE>NHTANFSMAYPSLIAMASQRQAKRERHKQK-ELEHRLSAIKSAVESGQA |
| Parental | DDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNTAQAE |
| DDERV.EYYLLHLQR..DISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNTAQ.. | |
| Retrocopy | DDERVCEYYLLHLQR*TDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNTAQVK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 3 .90 RPM | 19 .05 RPM |
| SRP007412_cerebellum | 3 .30 RPM | 26 .28 RPM |
| SRP007412_heart | 2 .45 RPM | 17 .72 RPM |
| SRP007412_kidney | 3 .48 RPM | 24 .63 RPM |
| SRP007412_liver | 1 .11 RPM | 9 .20 RPM |
| SRP007412_testis | 2 .11 RPM | 19 .18 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1317 |
| Pongo abelii | retro_pabe_1099 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000007797 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013654 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000012525 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000010797 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000014731 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000003397 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029688 | 1 retrocopy | |
| Homo sapiens | ENSG00000089289 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027795 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000004179 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013929 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000031221 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000747 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000011797 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020435 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000021990 | 5 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005483 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000026267 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006214 | 2 retrocopies |