RetrogeneDB ID: | retro_ptro_901 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 14:33844327..33844736(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | IGBP1 | ||
Ensembl ID: | ENSPTRG00000021990 | ||
Aliases: | None | ||
Description: | immunoglobulin (CD79A) binding protein 1 [Source:HGNC Symbol;Acc:5461] |
Percent Identity: | 88.49 % |
Parental protein coverage: | 52.67 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | CHCYHVAEFELPKTMNNSAE-NHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQA |
CHCYHVAE.ELPKT..NSAE.NHTAN.SMAYPSL.AMASQRQAK..R.KQK.ELEHRLSA.KSAVESGQA | |
Retrocopy | CHCYHVAELELPKT-KNSAE>NHTANFSMAYPSLIAMASQRQAKRERHKQK-ELEHRLSAIKSAVESGQA |
Parental | DDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNTAQAE |
DDERV.EYYLLHLQR..DISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNTAQ.. | |
Retrocopy | DDERVCEYYLLHLQR*TDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNTAQVK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 3 .90 RPM | 19 .05 RPM |
SRP007412_cerebellum | 3 .30 RPM | 26 .28 RPM |
SRP007412_heart | 2 .45 RPM | 17 .72 RPM |
SRP007412_kidney | 3 .48 RPM | 24 .63 RPM |
SRP007412_liver | 1 .11 RPM | 9 .20 RPM |
SRP007412_testis | 2 .11 RPM | 19 .18 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1317 |
Pongo abelii | retro_pabe_1099 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000007797 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013654 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000012525 | 6 retrocopies | |
Cavia porcellus | ENSCPOG00000010797 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000014731 | 5 retrocopies | |
Echinops telfairi | ENSETEG00000003397 | 1 retrocopy | |
Felis catus | ENSFCAG00000029688 | 1 retrocopy | |
Homo sapiens | ENSG00000089289 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000027795 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000004179 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013929 | 2 retrocopies | |
Mus musculus | ENSMUSG00000031221 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000747 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000011797 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000020435 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000021990 | 5 retrocopies | |
Pteropus vampyrus | ENSPVAG00000005483 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000026267 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000006214 | 2 retrocopies |