RetrogeneDB ID: | retro_pvam_661 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | GeneScaffold_60:195807..196024(+) | ||
| Located in intron of: | ENSPVAG00000004874 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA12 | ||
| Ensembl ID: | ENSPVAG00000007564 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 [Source:HGNC Symbol;Acc:23987] |
| Percent Identity: | 56.76 % |
| Parental protein coverage: | 85.88 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | QVSGHGGLRGYLRVLFRANDVRVGTLVGEDKYGNKYYEDNKQFFGRHRWV-IYTTEMNGKNTFWDVDGSM |
| ...GHG.LRG.L..LFRANDV.V.TLVGEDK...........F........IY..EMNGK.TFWDVDGSM | |
| Retrocopy | EIRGHGSLRGSLQILFRANDVTVVTLVGEDKIETNTMKTASRFLAATNGL>IYASEMNGK-TFWDVDGSM |
| Parental | VPPE |
| VP.E | |
| Retrocopy | VPHE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |