RetrogeneDB ID: | retro_rnor_1960 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 4:37214441..37214865(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Psma6 | ||
| Ensembl ID: | ENSRNOG00000007114 | ||
| Aliases: | None | ||
| Description: | Proteasome subunit alpha type-6 [Source:UniProtKB/Swiss-Prot;Acc:P60901] |
| Percent Identity: | 76.06 % |
| Parental protein coverage: | 56.5 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected: | 1 |
| Parental | MSRGSSAGFDRHITIFSP-EGRLYQVEYAFKAIN-QGGLTSVAVRGK-DCAVIVTQKKVPDKLLDSSTVT |
| MS..SS..FD.HITIFSP.EG.LYQVEYAFKA.N...GLTSVAVRGK.DC.VIVTQKKVP.K.LDSSTVT | |
| Retrocopy | MSHHSSPSFDHHITIFSPSEG*LYQVEYAFKAFNYHRGLTSVAVRGK>DCTVIVTQKKVPEKQLDSSTVT |
| Parental | HLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCC |
| .LFKITE.IGCV.T..TADS.SQ.QR.RYEA...K.KYGYEIPVDMLCKRIADISQ.YT.NAEMR.LG.. | |
| Retrocopy | DLFKITESIGCVVTEVTADS*SQIQRTRYEATK*K*KYGYEIPVDMLCKRIADISQTYT*NAEMRSLGFI |
| Parental | MI |
| .. | |
| Retrocopy | IV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 45 .08 RPM |
| SRP017611_kidney | 0 .00 RPM | 48 .01 RPM |
| SRP017611_liver | 0 .00 RPM | 44 .04 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000013409 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000004892 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026276 | 1 retrocopy | |
| Homo sapiens | ENSG00000100902 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000016537 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000083 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010228 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016544 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016288 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021024 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008492 | 10 retrocopies | |
| Pan troglodytes | ENSPTRG00000006264 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007114 | 4 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000011774 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011241 | 17 retrocopies |