RetrogeneDB ID: | retro_rnor_2039 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 4:21895193..21895388(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Eif3k | ||
| Ensembl ID: | ENSRNOG00000020495 | ||
| Aliases: | Eif3k, Eif3s12, PLAC-24 | ||
| Description: | eukaryotic translation initiation factor 3 subunit K [Source:RefSeq peptide;Acc:NP_001099712] |
| Percent Identity: | 69.7 % |
| Parental protein coverage: | 61.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | QALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLRVWMSKYGWSADES |
| QAL..N.DLL.GI.GFEDSV..FIC..VG...QHID.WLLAE.LGDLTD.QL.VWMS.YGWS..E. | |
| Retrocopy | QALVANTDLLKGISGFEDSV*QFICCGVGNMHQHID-WLLAERLGDLTDSQLKVWMSTYGWSTEET |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 22 .22 RPM |
| SRP017611_kidney | 0 .00 RPM | 26 .73 RPM |
| SRP017611_liver | 0 .00 RPM | 11 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000007594 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016808 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000013314 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026260 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025857 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020495 | 3 retrocopies |
retro_rnor_1128, retro_rnor_2039 , retro_rnor_513,
|
| Sarcophilus harrisii | ENSSHAG00000005313 | 1 retrocopy |