RetrogeneDB ID: | retro_mdom_1235 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 4:39327327..39327577(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF3K | ||
Ensembl ID: | ENSMODG00000013314 | ||
Aliases: | None | ||
Description: | eukaryotic translation initiation factor 3, subunit K [Source:HGNC Symbol;Acc:24656] |
Percent Identity: | 57.65 % |
Parental protein coverage: | 85.71 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | ENMDLLLLNGITGFEDSVRKFIC-HVVGITYQHIDRWLLAEMLGDLSDNQLKVWMSKYGWSSNEAGQVFI |
EN.DLLLLNG.TG.EDS...FIC..V..I.YQ..D.WL..E.LGDL.DN.LKV.MSK...S..E.GQ..I | |
Retrocopy | ENIDLLLLNGLTGLEDSIQIFIC>YVESILYQSTDCWLITEILGDL*DN*LKVQMSKCV*SFREGGQALI |
Parental | CSQEESIKPKNIVEK |
CSQ.E.....NI.E. | |
Retrocopy | CSQRE-YQA*NIIEQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000007594 | 3 retrocopies | |
Homo sapiens | ENSG00000178982 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000016808 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000010217 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000028767 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000013314 | 3 retrocopies |
retro_mdom_1235 , retro_mdom_1929, retro_mdom_781,
|
Otolemur garnettii | ENSOGAG00000026260 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025857 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000010934 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000020495 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000005313 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007001 | 1 retrocopy |