RetrogeneDB ID: | retro_pabe_2342 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:122780551..122780955(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF3K | ||
| Ensembl ID: | ENSPPYG00000025857 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 3, subunit K [Source:HGNC Symbol;Acc:24656] |
| Percent Identity: | 74.26 % |
| Parental protein coverage: | 76.7 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQ-TTVTAQI |
| ..MF.Q.R..VGKLL..I.RYN.ENLA.L..YVE.QAKENAYDLEANL.VLKLY.FNPAFF..T.VT..I | |
| Retrocopy | IVMF*QIRVSVGKLLNNIHRYNSENLASLGSYVEIQAKENAYDLEANLTVLKLY*FNPAFFR<TAVTTKI |
| Parental | LLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFE |
| .LKA.TN..HT.FTLCK.M..QAHQE..PI.QILYLGDLLE..HFQAFWQALDENM.LLEGITGFE | |
| Retrocopy | PLKAFTNPCHTNFTLCKDMVIQAHQEKQPIQQILYLGDLLEI*HFQAFWQALDENMTLLEGITGFE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .55 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 2 .19 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .32 RPM |
| SRP007412_kidney | 0 .00 RPM | 2 .19 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .35 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2616 |
| Pan troglodytes | retro_ptro_1763 |
| Macaca mulatta | retro_mmul_1478 |
| Macaca mulatta | retro_mmul_1542 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000007594 | 3 retrocopies | |
| Homo sapiens | ENSG00000178982 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016808 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010217 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000028767 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000013314 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026260 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025857 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000010934 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020495 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000005313 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007001 | 1 retrocopy |