RetrogeneDB ID: | retro_pabe_2342 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 3:122780551..122780955(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF3K | ||
Ensembl ID: | ENSPPYG00000025857 | ||
Aliases: | None | ||
Description: | eukaryotic translation initiation factor 3, subunit K [Source:HGNC Symbol;Acc:24656] |
Percent Identity: | 74.26 % |
Parental protein coverage: | 76.7 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQ-TTVTAQI |
..MF.Q.R..VGKLL..I.RYN.ENLA.L..YVE.QAKENAYDLEANL.VLKLY.FNPAFF..T.VT..I | |
Retrocopy | IVMF*QIRVSVGKLLNNIHRYNSENLASLGSYVEIQAKENAYDLEANLTVLKLY*FNPAFFR<TAVTTKI |
Parental | LLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFE |
.LKA.TN..HT.FTLCK.M..QAHQE..PI.QILYLGDLLE..HFQAFWQALDENM.LLEGITGFE | |
Retrocopy | PLKAFTNPCHTNFTLCKDMVIQAHQEKQPIQQILYLGDLLEI*HFQAFWQALDENMTLLEGITGFE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .55 RPM |
SRP007412_cerebellum | 0 .00 RPM | 2 .19 RPM |
SRP007412_heart | 0 .00 RPM | 1 .32 RPM |
SRP007412_kidney | 0 .00 RPM | 2 .19 RPM |
SRP007412_liver | 0 .00 RPM | 1 .35 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2616 |
Pan troglodytes | retro_ptro_1763 |
Macaca mulatta | retro_mmul_1478 |
Macaca mulatta | retro_mmul_1542 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000007594 | 3 retrocopies | |
Homo sapiens | ENSG00000178982 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000016808 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000010217 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000028767 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000013314 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000026260 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025857 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000010934 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000020495 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000005313 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007001 | 1 retrocopy |