RetrogeneDB ID: | retro_sara_307 | ||
Retrocopy location | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | scaffold_156225:8091..8306(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSSARG00000010597 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM14A | ||
| Ensembl ID: | ENSSARG00000005516 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 14A [Source:HGNC Symbol;Acc:21076] |
| Percent Identity: | 83.56 % |
| Parental protein coverage: | 83.72 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | IGFGYAALLTFGSILGYKRKG-GVPSLIAGLGVGFLAGYGAYRVSNDRRDIKLSLFTAFFLTTIMGVRFK |
| IGF.YAALLTFGS.LGYK.KG.GVPSLIAGLGVGFLA.YG.YRVS.DRR.I.LSLFTAFFLTTIMGVRF. | |
| Retrocopy | IGFWYAALLTFGSFLGYKGKG<GVPSLIAGLGVGFLATYGVYRVSSDRRHIRLSLFTAFFLTTIMGVRFN |
| Parental | RSK |
| ..K | |
| Retrocopy | PRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000005206 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000012581 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000016339 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008935 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000005516 | 1 retrocopy |
retro_sara_307 ,
|
| Tupaia belangeri | ENSTBEG00000011162 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000004269 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015237 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000004486 | 1 retrocopy |