RetrogeneDB ID: | retro_sscr_1194 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | X:54148113..54148479(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000006830 | ||
| Aliases: | None | ||
| Description: | Sus scrofa proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), mRNA. [Source:RefSeq mRNA;Acc:NM_001144901] |
| Percent Identity: | 52.71 % |
| Parental protein coverage: | 52.7 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | GVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEG-VCLAVEKRITSPLMEPSSIEK-IVEIDAHIGCAM |
| G.N..S...RLF...Y..E..KLGS.A.GIQTSE..VCLA.EK.ITS....PS.I.K....IDAH..C.. | |
| Retrocopy | GKNLLSLFPRLFHMQY--ETLKLGSIATGIQTSEV>VCLAIEKKITSYC--PSAIRK<VAYIDAHTSCTG |
| Parental | SGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPF |
| S.L...AKTL..KAR.ETQNH.FTY...MT.E......S.L...FG.EDADP.A....F | |
| Retrocopy | SMLLTEAKTLLNKARMETQNHLFTYKKIMTLENIA*FESSLHVKFG-EDADPDAVFHSF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 23 .23 RPM |
| SRP014902_testis | 0 .00 RPM | 24 .89 RPM |
| SRP018288_heart | 0 .00 RPM | 32 .01 RPM |
| SRP018288_kidney | 0 .00 RPM | 45 .31 RPM |
| SRP018288_liver | 0 .00 RPM | 46 .21 RPM |
| SRP018288_lung | 0 .00 RPM | 22 .71 RPM |
| SRP018856_adipose | 0 .00 RPM | 57 .25 RPM |
| SRP035408_brain | 0 .00 RPM | 49 .83 RPM |
| SRP035408_liver | 0 .00 RPM | 51 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000013670 | 1 retrocopy | |
| Equus caballus | ENSECAG00000011835 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000012916 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008497 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000003189 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000068749 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013560 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000008863 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008908 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019868 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006830 | 2 retrocopies |
retro_sscr_1156, retro_sscr_1194 ,
|