RetrogeneDB ID: | retro_sscr_284 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 11:47385614..47385952(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PTS | ||
| Ensembl ID: | ENSSSCG00000015040 | ||
| Aliases: | None | ||
| Description: | 6-pyruvoyltetrahydropterin synthase [Source:HGNC Symbol;Acc:9689] |
| Percent Identity: | 79.82 % |
| Parental protein coverage: | 77.4 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SASHRL-HSKSLSNEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPVTGMVMNLTDLKKYMEEAIMKPLD |
| S.SH.L.HSK.L.NEENLKLFGKCNNPNGHGHNYKVVV..HGEID.V.GM..N.TDLK.Y...AIMKPLD | |
| Retrocopy | STSHHL<HSKFLNNEENLKLFGKCNNPNGHGHNYKVVVIAHGEIDSVIGMILNSTDLKQYIGKAIMKPLD |
| Parental | HKNLDLDVPYFADVVSTTENVAVYIWENLQKYLPAGVLYKVKVY |
| HKNLD.DV.YFADVVS.TENVAVYIWENLQK.L..GVLYKV.VY | |
| Retrocopy | HKNLDMDVLYFADVVSMTENVAVYIWENLQKFLLVGVLYKVQVY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 8 .23 RPM |
| SRP014902_testis | 0 .00 RPM | 26 .31 RPM |
| SRP018288_heart | 0 .00 RPM | 42 .59 RPM |
| SRP018288_kidney | 0 .00 RPM | 60 .58 RPM |
| SRP018288_liver | 0 .00 RPM | 23 .51 RPM |
| SRP018288_lung | 0 .00 RPM | 14 .05 RPM |
| SRP018856_adipose | 0 .00 RPM | 9 .33 RPM |
| SRP035408_brain | 0 .00 RPM | 29 .79 RPM |
| SRP035408_liver | 0 .00 RPM | 19 .46 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003968 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000003770 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000013915 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
| Felis catus | ENSFCAG00000024702 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000023388 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000001975 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015040 | 1 retrocopy |
retro_sscr_284 ,
|
| Tursiops truncatus | ENSTTRG00000010526 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000000061 | 1 retrocopy |