RetrogeneDB ID: | retro_tsyr_1307 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
Coordinates: | scaffold_3889:40004..40232(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS18 | ||
Ensembl ID: | ENSTSYG00000012508 | ||
Aliases: | None | ||
Description: | ribosomal protein S18 [Source:HGNC Symbol;Acc:10401] |
Percent Identity: | 65.79 % |
Parental protein coverage: | 59.84 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLE |
VVLRK...DLTKRA..LTEDE.E...TI.QNP...K.PDW.LNRQKDVK.GKY.QVL.N.L.NKL.ED.E | |
Retrocopy | VVLRKTNTDLTKRARGLTEDEIEHAVTIIQNPHPHKVPDWSLNRQKDVKHGKYRQVLVNDLINKLYEDME |
Parental | RLKKIR |
RL.... | |
Retrocopy | RLPDLK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010356 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012508 | 8 retrocopies |
retro_tsyr_1121, retro_tsyr_1307 , retro_tsyr_1627, retro_tsyr_194, retro_tsyr_1949, retro_tsyr_2042, retro_tsyr_575, retro_tsyr_639,
|