RetrogeneDB ID: | retro_btau_1106 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 26:40282889..40283168(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | VMA21 | ||
| Ensembl ID: | ENSBTAG00000006296 | ||
| Aliases: | None | ||
| Description: | Vacuolar ATPase assembly integral membrane protein VMA21 [Source:UniProtKB/Swiss-Prot;Acc:A2VDK9] |
| Percent Identity: | 50.53 % |
| Parental protein coverage: | 94.06 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AALNALQPSDFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYVFEGAFGMSNRDSYFYAAIVAVVAV |
| AA.NA..P.......SLA.T.K..L.F..LM..VP.GLYF..K...F.....MS..DS.FYA.IVAVV.. | |
| Retrocopy | AAGNAAEPKP--EGGSLATTFKIFLLFAGLMVKVPVGLYFSCKLLLFQSLLLMSPDDSGFYATIVAVVGL |
| Parental | HVVLALFVYVAWNEGSRQWREGKQD |
| HVVLA.FV...W.EG...WRE.K.. | |
| Retrocopy | HVVLAVFVFIVWKEGMPDWREEKNE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 42 .90 RPM |
| ERP005899_muscle | 0 .11 RPM | 39 .91 RPM |
| SRP017611_brain | 36 .68 RPM | 61 .58 RPM |
| SRP017611_kidney | 0 .24 RPM | 107 .40 RPM |
| SRP017611_liver | 0 .08 RPM | 25 .82 RPM |
| SRP030211_testis | 1 .11 RPM | 28 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006296 | 1 retrocopy |
retro_btau_1106 ,
|
| Callithrix jacchus | ENSCJAG00000003916 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008426 | 1 retrocopy | |
| Homo sapiens | ENSG00000160131 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009034 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000073131 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013711 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015201 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020820 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000049744 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011179 | 1 retrocopy |