RetrogeneDB ID: | retro_mmul_1693 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 3:82479766..82480069(-) | ||
| Located in intron of: | ENSMMUG00000017382 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | VMA21 | ||
| Ensembl ID: | ENSMMUG00000009034 | ||
| Aliases: | None | ||
| Description: | VMA21 vacuolar H+-ATPase homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:22082] |
| Percent Identity: | 89.11 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAI |
| .ERPDKAALNALQPP.FR.ESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEG.LGMSNRD.YFYAA. | |
| Retrocopy | VERPDKAALNALQPPKFRKESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGTLGMSNRDRYFYAAS |
| Parental | VAVVAVHVVLALFVYVAWNEGSRQWREGKQD |
| VAVV..HVVLALF.YVAWNE.SRQW.EGKQD | |
| Retrocopy | VAVVGGHVVLALFMYVAWNEDSRQWCEGKQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .22 RPM | 7 .62 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 8 .25 RPM |
| SRP007412_cerebellum | 0 .26 RPM | 6 .52 RPM |
| SRP007412_heart | 0 .06 RPM | 4 .06 RPM |
| SRP007412_kidney | 0 .12 RPM | 6 .57 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .01 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .62 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3724 |
| Pongo abelii | retro_pabe_3133 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006296 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003916 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008426 | 1 retrocopy | |
| Homo sapiens | ENSG00000160131 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009034 | 1 retrocopy |
retro_mmul_1693 ,
|
| Mus musculus | ENSMUSG00000073131 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013711 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015201 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020820 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000049744 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011179 | 1 retrocopy |