RetrogeneDB ID: | retro_btau_1731 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | X:17711701..17711884(+) | ||
| Located in intron of: | ENSBTAG00000020406 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BT.65336 | ||
| Ensembl ID: | ENSBTAG00000038488 | ||
| Aliases: | None | ||
| Description: | thymosin beta-4 [Source:RefSeq peptide;Acc:NP_001106702] |
Retrocopy-Parental alignment summary:
>retro_btau_1731
ACAGCGCAGACCCGACTTCACTCGCTCGCAGTTCGCTTCGCACCCTCTGCAACCATGTCTGACAAACCCGATATGGCTGA
GATTAAGAAGTTCGATAAGTCGAAATTGAAGAAAATGGAAACGCAAGAGAAAAATCCACTGCCTTCGAAAGAAATGATTG
AAGAGAAGCAAGTAGGCGAGTCA
ORF - retro_btau_1731 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 88.71 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | TAQIRLHSLAVRSAPSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| TAQ.RLHSLAVR.APSATMSDKPDMAEI.KFDKSKLKK.ETQEKNPLPSKE.IE.EKQ.GES | |
| Retrocopy | TAQTRLHSLAVRFAPSATMSDKPDMAEIKKFDKSKLKKMETQEKNPLPSKEMIE-EKQVGES |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 80 .82 RPM |
| ERP005899_muscle | 0 .00 RPM | 479 .85 RPM |
| SRP017611_brain | 0 .00 RPM | 161 .66 RPM |
| SRP017611_kidney | 0 .00 RPM | 226 .77 RPM |
| SRP017611_liver | 0 .00 RPM | 38 .43 RPM |
| SRP030211_testis | 0 .02 RPM | 163 .41 RPM |
Bos taurus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_btau_1731 retrocopy.
Bos taurus was not studied using FANTOM5 data.
retro_btau_1731 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_btau_1731 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 4 parental genes, and 9 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038488 | 2 retrocopies |
retro_btau_1731 , retro_btau_599,
|
| Gorilla gorilla | ENSGGOG00000006450 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000014256 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000028317 | 4 retrocopies |