RetrogeneDB ID: | retro_btau_599 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 15:43739061..43739244(-) | ||
Located in intron of: | ENSBTAG00000016074 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BT.65336 | ||
Ensembl ID: | ENSBTAG00000038488 | ||
Aliases: | None | ||
Description: | thymosin beta-4 [Source:RefSeq peptide;Acc:NP_001106702] |
Percent Identity: | 95.16 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | TAQIRLHSLAVRSAPSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
TAQIRL.SLAVRSAPSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKE.IEQ.KQAGES | |
Retrocopy | TAQIRLDSLAVRSAPSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKEMIEQ-KQAGES |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 80 .82 RPM |
ERP005899_muscle | 0 .16 RPM | 479 .85 RPM |
SRP017611_brain | 0 .14 RPM | 161 .66 RPM |
SRP017611_kidney | 0 .12 RPM | 226 .77 RPM |
SRP017611_liver | 0 .00 RPM | 38 .43 RPM |
SRP030211_testis | 0 .09 RPM | 163 .41 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000038488 | 2 retrocopies |
retro_btau_1731, retro_btau_599 ,
|
Gorilla gorilla | ENSGGOG00000006450 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000014256 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000028317 | 4 retrocopies |