RetrogeneDB ID: | retro_mmul_1890 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 5:73796936..73797143(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMSB4X | ||
Ensembl ID: | ENSMMUG00000014256 | ||
Aliases: | None | ||
Description: | thymosin beta-4 [Source:RefSeq peptide;Acc:NP_001247486] |
Percent Identity: | 88.41 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | NSVVATAQTRLRSFSCASLRFSSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
NSVVAT.QTRLR.FS.A.LRF.SATMSDKPDMAEIEKF..SKLKKTETQEKNPLPSKET.EQEKQAGES | |
Retrocopy | NSVVATVQTRLRLFSRAWLRFPSATMSDKPDMAEIEKFGNSKLKKTETQEKNPLPSKETMEQEKQAGES |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 285 .39 RPM |
SRP007412_brain_prefrontal_cortex | 0 .63 RPM | 489 .94 RPM |
SRP007412_cerebellum | 0 .19 RPM | 126 .50 RPM |
SRP007412_heart | 0 .18 RPM | 382 .28 RPM |
SRP007412_kidney | 0 .00 RPM | 145 .65 RPM |
SRP007412_liver | 0 .04 RPM | 110 .99 RPM |
SRP007412_testis | 0 .00 RPM | 27 .25 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000038488 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000006450 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000014256 | 2 retrocopies |
retro_mmul_1274, retro_mmul_1890 ,
|
Pan troglodytes | ENSPTRG00000028317 | 4 retrocopies |