RetrogeneDB ID: | retro_btau_375 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 10:47918045..47918441(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRNP27 | ||
Ensembl ID: | ENSBTAG00000037746 | ||
Aliases: | SNRNP27, RY1 | ||
Description: | small nuclear ribonucleoprotein 27kDa (U4/U6.U5) [Source:RefSeq peptide;Acc:NP_001091631] |
Percent Identity: | 61.36 % |
Parental protein coverage: | 81.29 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | RSRSRERDRR---RSRSRSPHRR--RSRSPRRHRSTSPSPSRLKERRDEEKKETKETK-SKERQITEEDL |
RS.S.ER..R...RS.S....RR...SRSP.R.RS.SP...R.........KE..E.K..KE........ | |
Retrocopy | RSTSQEREHRHQERSQSSEGDRRGSHSRSPHRRRSRSPRRHRSTSPSPSRLKEEMEDKENKEQRM*DN*V |
Parental | EGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA |
...TEEE.EMMKLMGFASFDSTKGKKVDGSVNA.AIN.SQKRKY.QYMN.KGGFNRPLDFIA | |
Retrocopy | SNRTEEELEMMKLMGFASFDSTKGKKVDGSVNACAINTSQKRKYSQYMNGKGGFNRPLDFIA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 18 .02 RPM |
ERP005899_muscle | 0 .00 RPM | 6 .86 RPM |
SRP017611_brain | 0 .00 RPM | 4 .61 RPM |
SRP017611_kidney | 0 .00 RPM | 10 .19 RPM |
SRP017611_liver | 0 .00 RPM | 5 .06 RPM |
SRP030211_testis | 1 .95 RPM | 10 .73 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000037746 | 4 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000003042 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000017344 | 1 retrocopy | |
Homo sapiens | ENSG00000124380 | 1 retrocopy | |
Mus musculus | ENSMUSG00000001158 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000022967 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012332 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012022 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000025674 | 1 retrocopy |