RetrogeneDB ID: | retro_etel_655 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_132904:266..500(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRNP27 | ||
| Ensembl ID: | ENSETEG00000017344 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein 27kDa (U4/U6.U5) [Source:HGNC Symbol;Acc:30240] |
| Percent Identity: | 62.65 % |
| Parental protein coverage: | 51.27 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | QKETKEAKNKERQITEEDLEGKTEEEIEM-MKLMGFASFDSTKG-KKVDGSVNAYAINVSQKRKYRQYMN |
| .KE......KE.QI.EED.EGKTEEEIEM..KL.GFA...STKG.KK.....N.YAINV....KYRQ..N | |
| Retrocopy | KKEEMRTRKKEGQIPEEDSEGKTEEEIEM>LKLLGFA---STKG<KKSTAM*NPYAINVFSEEKYRQDVN |
| Parental | RKGGFNRPLDFIA |
| .KG.FNRPLDFIA | |
| Retrocopy | QKGAFNRPLDFIA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000037746 | 4 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000003042 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000017344 | 1 retrocopy |
retro_etel_655 ,
|
| Homo sapiens | ENSG00000124380 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000001158 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000022967 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012332 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012022 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025674 | 1 retrocopy |