RetrogeneDB ID: | retro_btau_791 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 19:24120958..24121246(-) | ||
Located in intron of: | ENSBTAG00000016806 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SEC61B | ||
Ensembl ID: | ENSBTAG00000002457 | ||
Aliases: | None | ||
Description: | protein transport protein Sec61 subunit beta [Source:RefSeq peptide;Acc:NP_001068760] |
Percent Identity: | 91.67 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MPGPAPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGP |
MPGPAPSGTN.GSSGRSPSKAVAAR.AGST..QRKNASCGTRSAG.TTSAGTGGM.RF.TEDSPGLKVGP | |
Retrocopy | MPGPAPSGTNMGSSGRSPSKAVAARSAGSTIQQRKNASCGTRSAGLTTSAGTGGM*RFNTEDSPGLKVGP |
Parental | VPVLVMSLLFIASVFMLHIWGKYTRS |
VPV.VMSLLFIASVFMLHIWGKYTRS | |
Retrocopy | VPVVVMSLLFIASVFMLHIWGKYTRS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 44 .05 RPM |
ERP005899_muscle | 0 .26 RPM | 79 .50 RPM |
SRP017611_brain | 0 .00 RPM | 11 .19 RPM |
SRP017611_kidney | 0 .00 RPM | 43 .98 RPM |
SRP017611_liver | 0 .08 RPM | 126 .55 RPM |
SRP030211_testis | 0 .03 RPM | 24 .64 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000002457 | 3 retrocopies |
retro_btau_1053, retro_btau_360, retro_btau_791 ,
|
Callithrix jacchus | ENSCJAG00000011279 | 1 retrocopy | |
Equus caballus | ENSECAG00000026930 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000005293 | 4 retrocopies | |
Homo sapiens | ENSG00000106803 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004205 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000000321 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000011121 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000001097 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010661 | 1 retrocopy | |
Mus musculus | ENSMUSG00000053317 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000017055 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000004168 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000019441 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021184 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000006345 | 1 retrocopy |