RetrogeneDB ID: | retro_ecab_711 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 3:32072072..32072329(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SEC61B | ||
Ensembl ID: | ENSECAG00000026930 | ||
Aliases: | None | ||
Description: | Sec61 beta subunit [Source:HGNC Symbol;Acc:16993] |
Percent Identity: | 52.87 % |
Parental protein coverage: | 88.54 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | VGSSGRSPSKAVAARAAGSTVRQRKNASC-GTRSAGRTTSAGTGGMWRFYTED-SPGLKVGPVPVLVMSL |
VG.....P.....A...GS........S..GT.SAGRTT.AG.GG..R..TE..SPGL.VGPVP.LV.SL | |
Retrocopy | VGRALVDPHRLLGALPVGSRAAPGRGRSRRGTGSAGRTTLAGSGGPGRSCTEG<SPGLSVGPVPLLVVSL |
Parental | LFIASVFMLHIWGKYTR |
L..ASVFM.HIW.K..R | |
Retrocopy | LIAASVFMSHIWSKDIR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .24 RPM | 29 .57 RPM |
SRP021940_cerebellum | 0 .21 RPM | 17 .76 RPM |
SRP021940_embryo | 0 .03 RPM | 31 .94 RPM |
SRP021940_placental_villous | 0 .05 RPM | 30 .60 RPM |
SRP021940_synovial_membrane | 0 .08 RPM | 33 .22 RPM |
SRP021940_testis | 0 .06 RPM | 62 .86 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000002457 | 3 retrocopies | |
Equus caballus | ENSECAG00000026930 | 1 retrocopy |
retro_ecab_711 ,
|
Echinops telfairi | ENSETEG00000005293 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000004205 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000000321 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000011121 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000001097 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010661 | 1 retrocopy | |
Mus musculus | ENSMUSG00000053317 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000017055 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000004168 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000019441 | 1 retrocopy |