RetrogeneDB ID: | retro_etel_1889 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_311941:7600..7857(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SEC61B | ||
Ensembl ID: | ENSETEG00000005293 | ||
Aliases: | None | ||
Description: | Sec61 beta subunit [Source:HGNC Symbol;Acc:16993] |
Percent Identity: | 52.87 % |
Parental protein coverage: | 88.54 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | GSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRT-TSAGTGGMWR-FYTEDSPGLKVGPVPVLVMSLL |
G..GR...K...A.A......Q........R...R..TSAGTG.M...F.TEDSP.LKVGPVP.LVMSLL | |
Retrocopy | GNLGRKS*KSQPAAAYFWRLYQPSSGWAA*RENARCRTSAGTGDMGS<FNTEDSPELKVGPVPRLVMSLL |
Parental | FIASVFMLHIWGKYTRS |
...SV.ML..WGKYTRS | |
Retrocopy | LFTSVLMLAMWGKYTRS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000002457 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000011279 | 1 retrocopy | |
Equus caballus | ENSECAG00000026930 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000005293 | 4 retrocopies | |
Homo sapiens | ENSG00000106803 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004205 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000000321 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000011121 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000001097 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010661 | 1 retrocopy | |
Mus musculus | ENSMUSG00000053317 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000017055 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000004168 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000019441 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021184 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000006345 | 1 retrocopy |