RetrogeneDB ID: | retro_cfam_2154 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | X:44096696..44097128(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DCTN6 | ||
Ensembl ID: | ENSCAFG00000006518 | ||
Aliases: | None | ||
Description: | dynactin 6 [Source:HGNC Symbol;Acc:16964] |
Percent Identity: | 72.79 % |
Parental protein coverage: | 76.32 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | EKAQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGE-GNLIEEQALIINAHPDNIT |
....K.VKI.PGAVV.VESE..GD.T.GPRTVIH.KA.IIAE......GE..NL.EEQ.LIINA..DNIT | |
Retrocopy | QRRLKRVKIPPGAVVYVESETWGDITTGPRTVIHSKAQIIAEVR-LIVGE<SNLFEEQVLIINAYLDNIT |
Parental | PDAEDPEPKPMIIGTNNVFEVGCYSQAMK-MGDNNVIESKAYVGRNVILTSGCIIGACCSLNTFEVIPEN |
P.A.DP..KPMIIGTNN.FEVGCYSQAMK.MG..NVI.SKAYV..NVILTSGCI..ACC.LNTFEVIPEN | |
Retrocopy | PNADDPDLKPMIIGTNNDFEVGCYSQAMK>MGNHNVIVSKAYVE*NVILTSGCITVACCNLNTFEVIPEN |
Parental | TVIYGAD |
TVI.GAD | |
Retrocopy | TVIDGAD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 31 .88 RPM |
SRP017611_brain | 0 .00 RPM | 25 .96 RPM |
SRP017611_kidney | 0 .00 RPM | 49 .46 RPM |
SRP017611_liver | 0 .00 RPM | 6 .45 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001497 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000006518 | 1 retrocopy |
retro_cfam_2154 ,
|
Choloepus hoffmanni | ENSCHOG00000002554 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000011021 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000012307 | 2 retrocopies | |
Felis catus | ENSFCAG00000000133 | 1 retrocopy | |
Homo sapiens | ENSG00000104671 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013074 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000028330 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000013735 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019010 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011906 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000010968 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000005061 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000020134 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013306 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000012439 | 1 retrocopy |