RetrogeneDB ID: | retro_cpor_706 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_24:15543469..15543809(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DCTN6 | ||
Ensembl ID: | ENSCPOG00000011021 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 60.87 % |
Parental protein coverage: | 60. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | LEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGR-NVILTSGCIIGACCNLNTFEVIPENTVIYG |
L.P........NVF...CYS..MKMGDN.VIESK.Y......ILTSG...GA.CNLNTFEVIPE...I.G | |
Retrocopy | LNPSGTMTNGTNVFKIHCYS*VMKMGDN-VIESKTYIRK>YIILTSGYPTGAFCNLNTFEVIPEKAEISG |
Parental | ADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTTKGSSTPVKN |
A..L..V.T...QPQTL.LD.LMKILPN..HLKK..KGSS.PVKN | |
Retrocopy | AARLHQVWTDQLQPQTLKLDLLMKILPNPYHLKKNRKGSSSPVKN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 25 .94 RPM |
SRP017611_kidney | 0 .00 RPM | 19 .79 RPM |
SRP017611_liver | 0 .00 RPM | 9 .05 RPM |
SRP040447_lung | 0 .03 RPM | 13 .47 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 12 .55 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001497 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000006518 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000002554 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000011021 | 2 retrocopies |
retro_cpor_1437, retro_cpor_706 ,
|
Echinops telfairi | ENSETEG00000012307 | 2 retrocopies | |
Felis catus | ENSFCAG00000000133 | 1 retrocopy | |
Homo sapiens | ENSG00000104671 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013074 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000028330 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000013735 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019010 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011906 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000010968 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000005061 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000020134 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013306 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000012439 | 1 retrocopy |