RetrogeneDB ID: | retro_cfam_381 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 10:35354501..35354717(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGN2 | ||
Ensembl ID: | ENSCAFG00000023168 | ||
Aliases: | HMGN2, HMG-17 | ||
Description: | Canis lupus familiaris non-histone chromosomal protein HMG-17 (HMGN2), mRNA. [Source:RefSeq mRNA;Acc:NM_001003101] |
Percent Identity: | 91.67 % |
Parental protein coverage: | 80. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKDGNNPA |
MPKRKAEGDAKGDKAKVKDEPQRRSARLSAK.APPKP.PK..KAPAKKGEK.PKGKKGKADAGKDGNNP. | |
Retrocopy | MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKSAPPKPVPKSQKAPAKKGEKAPKGKKGKADAGKDGNNPE |
Parental | EN |
EN | |
Retrocopy | EN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 112 .05 RPM |
SRP017611_brain | 0 .00 RPM | 22 .87 RPM |
SRP017611_kidney | 0 .00 RPM | 60 .82 RPM |
SRP017611_liver | 0 .00 RPM | 19 .14 RPM |