RetrogeneDB ID: | retro_chof_613 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | scaffold_12675:11581..11806(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NEDD8 | ||
Ensembl ID: | ENSCHOG00000001228 | ||
Aliases: | None | ||
Description: | neural precursor cell expressed, developmentally down-regulated 8 [Source:HGNC Symbol;Acc:7732] |
Percent Identity: | 54.67 % |
Parental protein coverage: | 92.59 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | IKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLA |
I.VKTLTGK.I.....P.D..E..K.....KE.IPP.QQRLI..GKQ..D..T..DY.I...S.LHLVL. | |
Retrocopy | IFVKTLTGKTITLEVDPSDTIENVKAKIQDKEAIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR |
Parental | LRGGS |
LRGG. | |
Retrocopy | LRGGA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
Homo sapiens | ENSG00000129559 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |