RetrogeneDB ID: | retro_cjac_4064 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | X:52388688..52388922(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000031713 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000006876 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 93.67 % |
| Parental protein coverage: | 96.34 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLAL |
| KVKTLTGKEI.IDIEPTDKVERIKERVEEK.GIPPQQQRLIYSGKQMNDEKT.ADYKILGGSVLHL.LAL | |
| Retrocopy | KVKTLTGKEIKIDIEPTDKVERIKERVEEKQGIPPQQQRLIYSGKQMNDEKTTADYKILGGSVLHLMLAL |
| Parental | RGGGGGLRQ |
| R.GGGGLRQ | |
| Retrocopy | R-GGGGLRQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 10 .74 RPM |
| SRP051959_heart | 0 .00 RPM | 16 .89 RPM |
| SRP051959_kidney | 0 .04 RPM | 17 .13 RPM |
| SRP051959_liver | 0 .00 RPM | 16 .70 RPM |
| SRP051959_lung | 0 .00 RPM | 14 .82 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 12 .81 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 18 .37 RPM |
| SRP051959_spleen | 0 .00 RPM | 16 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy |
retro_cjac_4064 ,
|
| Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
| Homo sapiens | ENSG00000129559 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |