RetrogeneDB ID: | retro_mdom_1681 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 6:174770131..174770354(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NEDD8 | ||
Ensembl ID: | ENSMODG00000003254 | ||
Aliases: | None | ||
Description: | neural precursor cell expressed, developmentally down-regulated 8 [Source:HGNC Symbol;Acc:7732] |
Percent Identity: | 73.33 % |
Parental protein coverage: | 91.36 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | LTGKEIE-IDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKIQGGSVLHLVLALRGG |
LTGKEIE.ID.E...KVE.IKERVEEKEGIP...Q.LIYSGKQM.D.KT..D.KIQG.SVLHL..AL.GG | |
Retrocopy | LTGKEIE>IDTESIGKVEWIKERVEEKEGIPL*PQQLIYSGKQMKD*KTGSDSKIQGHSVLHLLFALCGG |
Parental | GGLGR |
G.LGR | |
Retrocopy | GDLGR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 204 .54 RPM |
SRP007412_cerebellum | 0 .00 RPM | 255 .94 RPM |
SRP007412_heart | 0 .00 RPM | 155 .49 RPM |
SRP007412_kidney | 0 .00 RPM | 160 .65 RPM |
SRP007412_liver | 0 .00 RPM | 129 .40 RPM |
SRP007412_testis | 0 .00 RPM | 167 .36 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
Homo sapiens | ENSG00000129559 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy |
retro_mdom_1681 ,
|
Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |