RetrogeneDB ID: | retro_cpor_371 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_135:1226534..1226725(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NEDD8 | ||
Ensembl ID: | ENSCPOG00000010930 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68.18 % |
Parental protein coverage: | 79.01 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | LFLKVVTLT-GKEIEIDIEPTDKVERIKERVEE-KEGIPPQQQRLIYSGKQMNDEKTAADYKILGG |
...KV..LT.GK.IE..IEPTDKVER.KE..EE.....PPQQQRL.Y.GKQM.DEKTAADY.ILGG | |
Retrocopy | MLMKVKRLT>GKQIETGIEPTDKVERVKEQ-EE>RQRAPPQQQRLSYGGKQMHDEKTAADYEILGG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 38 .71 RPM |
SRP017611_kidney | 0 .00 RPM | 39 .26 RPM |
SRP017611_liver | 0 .22 RPM | 25 .90 RPM |
SRP040447_lung | 0 .00 RPM | 30 .79 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 40 .37 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy |
retro_cpor_371 ,
|
Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy |