RetrogeneDB ID: | retro_cjac_2527 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:64991904..64992285(+) | ||
| Located in intron of: | ENSCJAG00000009042 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BRI3 | ||
| Ensembl ID: | ENSCJAG00000015227 | ||
| Aliases: | None | ||
| Description: | brain protein I3 [Source:HGNC Symbol;Acc:1109] |
| Percent Identity: | 74.02 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPP--PYPYLVTGIPTHHPRVYNIHSRTVTRYP |
| .DH..LLQE..P.YNL.AGQ.D.AC.PHGYGAI....P....P.PYL.TGIPTHHPRVYN.HSRT.TRYP | |
| Retrocopy | IDHGLLLQEWLPTYNLGAGQVDGACSPHGYGAILLPTPSHCLPSPYLITGIPTHHPRVYNCHSRTITRYP |
| Parental | ANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA |
| AN.I...GGC.VCRVGVLEDCFTFLGI.LAIILFPFGFIC.FALRK.RCPN.G..FA | |
| Retrocopy | ANAIIIMGGCHVCRVGVLEDCFTFLGILLAIILFPFGFIC*FALRKQRCPNFGEDFA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 9 .98 RPM |
| SRP051959_heart | 0 .00 RPM | 21 .07 RPM |
| SRP051959_kidney | 0 .04 RPM | 14 .93 RPM |
| SRP051959_liver | 0 .00 RPM | 20 .95 RPM |
| SRP051959_lung | 0 .00 RPM | 12 .48 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 8 .29 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 23 .28 RPM |
| SRP051959_spleen | 0 .00 RPM | 17 .65 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000015227 | 1 retrocopy |
retro_cjac_2527 ,
|
| Homo sapiens | ENSG00000164713 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009646 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000002888 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013275 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000000638 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025815 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000019436 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015705 | 2 retrocopies |