RetrogeneDB ID: | retro_cjac_467 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 1:136737788..136738034(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SYF2 | ||
Ensembl ID: | ENSCJAG00000018559 | ||
Aliases: | None | ||
Description: | SYF2 homolog, RNA splicing factor (S. cerevisiae) [Source:HGNC Symbol;Acc:19824] |
Percent Identity: | 52.38 % |
Parental protein coverage: | 53.85 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KARLEWELQEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQ |
K....WE......K.E.....E...K.........D.ERWERKKKRKN..LGF..YAA.QL.QYH.LTKQ | |
Retrocopy | KLPANWEANKHHFKWEL--QEEGGKKNVQTKTMRKDTERWERKKKRKNFNLGFLHYAASQLHQYHWLTKQ |
Parental | IKPDMETYERLREK |
IKPD.E.Y.RL.EK | |
Retrocopy | IKPDTEIY*RLTEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 4 .53 RPM |
SRP051959_heart | 0 .00 RPM | 6 .47 RPM |
SRP051959_kidney | 0 .00 RPM | 7 .94 RPM |
SRP051959_liver | 0 .00 RPM | 4 .14 RPM |
SRP051959_lung | 0 .02 RPM | 7 .84 RPM |
SRP051959_lymph_node | 0 .00 RPM | 6 .94 RPM |
SRP051959_skeletal_muscle | 0 .04 RPM | 7 .40 RPM |
SRP051959_spleen | 0 .00 RPM | 7 .29 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4152 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010115 | 1 retrocopy | |
Bos taurus | ENSBTAG00000001651 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000005273 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000018559 | 1 retrocopy |
retro_cjac_467 ,
|
Homo sapiens | ENSG00000117614 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000013951 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000013050 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000007152 | 1 retrocopy |