RetrogeneDB ID: | retro_cjac_868 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 11:90761605..90761848(+) | ||
Located in intron of: | ENSCJAG00000006191 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CRB3 | ||
Ensembl ID: | ENSCJAG00000016567 | ||
Aliases: | None | ||
Description: | crumbs homolog 3 (Drosophila) [Source:HGNC Symbol;Acc:20237] |
Percent Identity: | 75.86 % |
Parental protein coverage: | 70.16 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MANPGLGLLLALGLPFLLARWGRAWGQVPTSSANESSTVLPTSTSPSSSSSSNGTLSQGAITAIIVVFSI |
MANPGLGLLL.LGLP.LLARWG.AW.Q..T.SANESST.L...TSP..SSSS.G.LSQGAITAIIVVFS. | |
Retrocopy | MANPGLGLLLVLGLPLLLARWG*AWSQTSTPSANESSTILLIHTSP--SSSSHGALSQGAITAIIVVFSL |
Parental | LAALLLAVGLALLVRKL |
L....LAVGLALLV.KL | |
Retrocopy | L----LAVGLALLVWKL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .02 RPM | 5 .52 RPM |
SRP051959_heart | 0 .04 RPM | 0 .07 RPM |
SRP051959_kidney | 0 .04 RPM | 5 .28 RPM |
SRP051959_liver | 0 .09 RPM | 1 .39 RPM |
SRP051959_lung | 0 .07 RPM | 2 .41 RPM |
SRP051959_lymph_node | 0 .02 RPM | 1 .14 RPM |
SRP051959_skeletal_muscle | 0 .59 RPM | 0 .02 RPM |
SRP051959_spleen | 0 .00 RPM | 0 .29 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000016567 | 1 retrocopy |
retro_cjac_868 ,
|
Homo sapiens | ENSG00000130545 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007070 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000005599 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015936 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009457 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000010367 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000047322 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000002396 | 1 retrocopy |