RetrogeneDB ID: | retro_mmul_1434 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 2:59610327..59610624(+) | ||
Located in intron of: | ENSMMUG00000008549 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CRB3 | ||
Ensembl ID: | ENSMMUG00000005599 | ||
Aliases: | None | ||
Description: | crumbs protein homolog 3 precursor [Source:RefSeq peptide;Acc:NP_001253010] |
Percent Identity: | 67.33 % |
Parental protein coverage: | 80.49 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | WGQRLASSAYDSSTVVPSPTSSSSNGNLSQE-AITAIIVVFSILAILLLAVGLALLVWKLREKRQTEGTY |
W.Q....SA..SS.V.P.PTSS.SNG.LSQ..A.TAIIV.F..LA.L.LAVGLALLV.KLRE.RQTEGTY | |
Retrocopy | WAQIPTPSANESSIVLPTPTSSGSNGALSQG>AVTAIIVFF*FLAVLFLAVGLALLVRKLREMRQTEGTY |
Parental | RPSSEEQFSHAAE-ARAPQDSKETVRGCLPI |
.PSSEEQFS..A..A.APQDS.ET..G.L.I | |
Retrocopy | WPSSEEQFSYVAG<AWAPQDSNETLWGYLHI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .34 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .59 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .23 RPM |
SRP007412_heart | 0 .00 RPM | 0 .18 RPM |
SRP007412_kidney | 0 .00 RPM | 8 .22 RPM |
SRP007412_liver | 0 .00 RPM | 9 .90 RPM |
SRP007412_testis | 0 .00 RPM | 0 .11 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2747 |
Gorilla gorilla | retro_ggor_1910 |
Pongo abelii | retro_pabe_2222 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000016567 | 1 retrocopy | |
Homo sapiens | ENSG00000130545 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007070 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000005599 | 1 retrocopy |
retro_mmul_1434 ,
|
Nomascus leucogenys | ENSNLEG00000015936 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009457 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000010367 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000047322 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000002396 | 1 retrocopy |