RetrogeneDB ID: | retro_cpor_232 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_103:1646703..1646922(-) | ||
Located in intron of: | ENSCPOG00000013291 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GABARAPL1 | ||
Ensembl ID: | ENSCPOG00000006718 | ||
Aliases: | None | ||
Description: | Gamma-aminobutyric acid receptor-associated protein-like 1 [Source:UniProtKB/Swiss-Prot;Acc:P60518] |
Percent Identity: | 54.43 % |
Parental protein coverage: | 65.81 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | VPDLDKRKYLVPSDLTVGQFYFLIRKRIHLR-PEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAY |
VPDL.K.KYLVPSD..VGQFYFLI.K......P.D.LF......IPP.S.T........HEEDYFL.VA. | |
Retrocopy | VPDLNKGKYLVPSDM-VGQFYFLIWKKLIKN>PKDPLFAV---NIPPISVTWATHTRTPHEEDYFLSVAQ |
Parental | -SDESVYGK |
.....VYGK | |
Retrocopy | <TGMRVYGK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 351 .66 RPM |
SRP017611_kidney | 0 .00 RPM | 432 .78 RPM |
SRP017611_liver | 0 .00 RPM | 313 .78 RPM |
SRP040447_lung | 0 .00 RPM | 158 .87 RPM |
SRP040447_skeletal_muscle | 0 .01 RPM | 32 .69 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000006718 | 1 retrocopy |
retro_cpor_232 ,
|
Cavia porcellus | ENSCPOG00000023922 | 1 retrocopy | |
Homo sapiens | ENSG00000139112 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000016834 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000007434 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000002246 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000005307 | 19 retrocopies |
retro_tsyr_1045, retro_tsyr_1070, retro_tsyr_1101, retro_tsyr_1137, retro_tsyr_1308, retro_tsyr_1413, retro_tsyr_1467, retro_tsyr_1481, retro_tsyr_1671, retro_tsyr_1765, retro_tsyr_1800, retro_tsyr_234, retro_tsyr_573, retro_tsyr_761, retro_tsyr_796, retro_tsyr_832, retro_tsyr_864, retro_tsyr_978, retro_tsyr_999,
|