RetrogeneDB ID: | retro_cpor_494 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_17:31457518..31457728(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MPC2 | ||
| Ensembl ID: | ENSCPOG00000003860 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 80.0 % |
| Parental protein coverage: | 55.56 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSAAGARGLRALHHRLLDRVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTA |
| .SAAG..GL.ALHH.LLDRVE.ML..KLRPL.NHPAGPRTVFFWAP.MKW.L.CAGLAD.ARPAEKLS.A | |
| Retrocopy | LSAAGVQGLGALHHWLLDRVEMMLLKKLRPLSNHPAGPRTVFFWAPMMKWSLTCAGLADIARPAEKLSPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 18 .23 RPM |
| SRP017611_kidney | 0 .00 RPM | 48 .68 RPM |
| SRP017611_liver | 0 .00 RPM | 50 .93 RPM |
| SRP040447_lung | 0 .00 RPM | 17 .96 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 89 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006273 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020968 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015358 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007752 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016985 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003860 | 1 retrocopy |
retro_cpor_494 ,
|
| Dasypus novemcinctus | ENSDNOG00000011180 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011691 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011873 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010387 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026568 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003130 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000006304 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014189 | 9 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010251 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008566 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000010556 | 1 retrocopy |